| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : Q17A98
dbSWEET id: dbswt_1220
Accession: Q17A98
Uniprot status: Unreviewed
Organism: Aedes aegypti
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Culicinae ⇒ Aedini ⇒ Aedes ⇒ Stegomyia.
Sequence Information back to top
Sequence length: 228
Substrate Binding Site: TSWK CVV: 464 CHI: -6.3
Selectivity Filter: QLYA CVV: 446 CHI: 0.8
Fasta sequence:
>tr|Q17A98|Q17A98_AEDAE|Unreviewed|Aedes_aegypti|228
MDSLARVLLPYRDVIGNVAGILTIAQFLSGCFTCNKIRLKGSSEGFSALQFVFGCGLTIL
QLKYSQMLRSAPLIRTSSYALAICLAYSGCYLFYTPRGKRNDFWKLVMRTILLVGGALLY
AGFENPALVKDRFGLLVTILTLSYIGLPLLKLGEVIKNKSSEGLPLPVIMASTGASVLWL
LYGIILHNYFIIVQKVIALGLCAVQLSLFLIYPAPSKAAREHKKPKGE
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 214
Alignment file: Q17A98.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q17A98_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.4% favored 11.0% allowed .0% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q17A98_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.4% favored 6.1% allowed .6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q17A98_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.2% favored 7.2% allowed 1.1% week .6% disallowed
Gene Informationback to top
Gene ID: 5566372 Total Exons: 4 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number




Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5