Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q17757

dbSWEET id: dbswt_1218

Accession:   Q17757

Uniprot status:   Unreviewed

Organism:   Caenorhabditis elegans

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   355

Substrate Binding Site:   GQWN           CVV:   355       CHI:   -5.2

Selectivity Filter:   LGDV           CVV:   368       CHI:   4.1

Fasta sequence:

>tr|Q17757|Q17757_CAEEL|Unreviewed|Caenorhabditis_elegans|355
MFEIFTQGFSLLNLLSILAFFTTVGLFFCGIPICRQIWKRKDTKEISGAPFLMGVVGGCC
WMTYGWLKNDGTVKWVTGCQVILYTTYTIFYWCMTKKKLYISLKVLGVIGICTSLVLAVH
FFGMKIFHPLGIVCLTLNIADFAAPLGGIRVVIRRWATSTLPLPLCIANFLVSTEWFLYG
LLKNDFYLIFPNGVGSLLAFIQLLLFIVLPRKPGQRAPIVRLWLWIRGVRVEETKEIVAE
LGECDEKDDKKMNRAQRWSQKIKMNVSTVAEELENVIYQLPTKDQFAYTHKIGDEDSSSE
KTVETVDETKKAPVTAVDKLKDADRERKMRNALRAAQDARENALRRTISSPDLSE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   211

Alignment file: Q17757.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  Q17757_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.2% favored    9.6% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  Q17757_outward.pdb

Procheck score ⇒ Ramachandran plot: 89.3% favored    10.1% allowed    .0% week    .6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  Q17757_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.0% favored    6.2% allowed    2.2% week    .6% disallowed

Gene Informationback to top


Gene ID:   177972     Total Exons:   3     Coding Exons:   3

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur