Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : Q17757
dbSWEET id: dbswt_1218
Accession: Q17757
Uniprot status: Unreviewed
Organism: Caenorhabditis elegans
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.
Sequence Information back to top
Sequence length: 355
Substrate Binding Site: GQWN CVV: 355 CHI: -5.2
Selectivity Filter: LGDV CVV: 368 CHI: 4.1
Fasta sequence:
>tr|Q17757|Q17757_CAEEL|Unreviewed|Caenorhabditis_elegans|355
MFEIFTQGFSLLNLLSILAFFTTVGLFFCGIPICRQIWKRKDTKEISGAPFLMGVVGGCC
WMTYGWLKNDGTVKWVTGCQVILYTTYTIFYWCMTKKKLYISLKVLGVIGICTSLVLAVH
FFGMKIFHPLGIVCLTLNIADFAAPLGGIRVVIRRWATSTLPLPLCIANFLVSTEWFLYG
LLKNDFYLIFPNGVGSLLAFIQLLLFIVLPRKPGQRAPIVRLWLWIRGVRVEETKEIVAE
LGECDEKDDKKMNRAQRWSQKIKMNVSTVAEELENVIYQLPTKDQFAYTHKIGDEDSSSE
KTVETVDETKKAPVTAVDKLKDADRERKMRNALRAAQDARENALRRTISSPDLSE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 211
Alignment file: Q17757.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q17757_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.2% favored 9.6% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q17757_outward.pdb
Procheck score ⇒ Ramachandran plot: 89.3% favored 10.1% allowed .0% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q17757_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.0% favored 6.2% allowed 2.2% week .6% disallowed
Gene Informationback to top
Gene ID: 177972 Total Exons: 3 Coding Exons: 3
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA