Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : Q176S9
dbSWEET id: dbswt_1217
Accession: Q176S9
Uniprot status: Unreviewed
Organism: Aedes aegypti
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Culicinae ⇒ Aedini ⇒ Aedes ⇒ Stegomyia.
Sequence Information back to top
Sequence length: 232
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: QSFV CVV: 427 CHI: 2.7
Fasta sequence:
>tr|Q176S9|Q176S9_AEDAE|Unreviewed|Aedes_aegypti|232
MPLFDDLSFKDILASSATISTVLQFLTGSVICHRYIRKKSTGETSAFPFVSGFLSCSLWL
KYGLLSEEHTIIFVNTIGSALFFAYVIIYFTFSVNKRTVVRQFLAVCCFILACSVYTKYE
PNSETALEVIGLICCGVGVLFFASPLTVLAQVIRTKNTESLPFPIIISSFFVSLQWFIYG
MVIEDSFIQIPNLLGCILSSIQLLLYAIYPNRKLYSDGGPSYQPLRSDANIL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 211
Alignment file: Q176S9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q176S9_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.4% favored 9.5% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q176S9_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.0% favored 7.9% allowed .5% week 1.6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q176S9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.5% favored 9.5% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 5567697 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA