Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q174X0

dbSWEET id: dbswt_1216

Accession:   Q174X0

Uniprot status:   Unreviewed

Organism:   Aedes aegypti

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Culicinae ⇒ Aedini ⇒ Aedes ⇒ Stegomyia.

Sequence Information back to top


Sequence length:   228

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   QFLV           CVV:   478       CHI:   7.3

Fasta sequence:

>tr|Q174X0|Q174X0_AEDAE|Unreviewed|Aedes_aegypti|228
MEALAVALQPYKDTVGLSAAVITVLQFFSGVFVVNDIRRKGSSEGFSAGPFLGGAVFSLL
NVQFGQMLQDDAMIKVNLIGLGLNVLYVCAFYWYTLGPAKNKVWGQIGLAGAIAAGLLAY
VQYEDPKVVEFRFGMILTVILLILVGMPLLGLGEILKNKSTEGLPFPIILSGSFVSLAWL
LYGVILRSNFLVAQNVIALALGLVQLSLFVIFPSKPAKKATKSDKKKN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   214

Alignment file: Q174X0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  Q174X0_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    8.5% allowed    .6% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  Q174X0_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    7.9% allowed    .6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  Q174X0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    7.3% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   5568325     Total Exons:   3     Coding Exons:   3

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur