| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : Q174X0
dbSWEET id: dbswt_1216
Accession: Q174X0
Uniprot status: Unreviewed
Organism: Aedes aegypti
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Culicinae ⇒ Aedini ⇒ Aedes ⇒ Stegomyia.
Sequence Information back to top
Sequence length: 228
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: QFLV CVV: 478 CHI: 7.3
Fasta sequence:
>tr|Q174X0|Q174X0_AEDAE|Unreviewed|Aedes_aegypti|228
MEALAVALQPYKDTVGLSAAVITVLQFFSGVFVVNDIRRKGSSEGFSAGPFLGGAVFSLL
NVQFGQMLQDDAMIKVNLIGLGLNVLYVCAFYWYTLGPAKNKVWGQIGLAGAIAAGLLAY
VQYEDPKVVEFRFGMILTVILLILVGMPLLGLGEILKNKSTEGLPFPIILSGSFVSLAWL
LYGVILRSNFLVAQNVIALALGLVQLSLFVIFPSKPAKKATKSDKKKN
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 214
Alignment file: Q174X0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q174X0_inward.pdb
Procheck score ⇒ Ramachandran plot: 89.8% favored 8.5% allowed .6% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q174X0_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 7.9% allowed .6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q174X0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 7.3% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 5568325 Total Exons: 3 Coding Exons: 3
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number



Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5