Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q11VQ0

dbSWEET id: dbswt_1880

Accession:   Q11VQ0

Uniprot status:   Unreviewed

Organism:   Cytophaga hutchinsonii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Cytophagia ⇒ Cytophagales ⇒ Cytophagaceae ⇒ Cytophaga.

Sequence Information back to top


Sequence length:   94

Substrate Binding Site:   GNGN           CVV:   288       CHI:   -7.8

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|Q11VQ0|Q11VQ0_CYTH3|Unreviewed|Cytophaga hutchinsonii|94
MDWIVVTGVCASMCTALSLLPQLIKVLRTKKAEDVSYLMLAVLFTGGILWIVYGVMREDW
IIIGSNTISVLINIISCWASIKYRPKDKMIKELM

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  Q11VQ0_inward.pdb    Alignment file: Q11VQ0_inw.pir

Procheck score ⇒ Ramachandran plot: 91.3% favored    8.7% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  Q11VQ0_outward.pdb    Alignment file: Q11VQ0_out.pir

Procheck score ⇒ Ramachandran plot: 92.8% favored    7.2% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  Q11VQ0_occluded.pdb    Alignment file: Q11VQ0_occ.pir

Procheck score ⇒ Ramachandran plot: 96.4% favored    3.6% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur