Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : Q10LN5
dbSWEET id: dbswt_431
Accession: Q10LN5
Uniprot status: Reviewed
Organism: Oryza sativa
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.
Sequence Information back to top
Sequence length: 328
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: VSMN CVV: 398 CHI: 1.8
Fasta sequence:
>sp|Q10LN5|SWT16_ORYSJ|Reviewed|Oryza_sativa|328
MADPSFFVGIVGNVISILVFASPIATFRRIVRSKSTEEFRWLPYVTTLLSTSLWTFYGLH
KPGGLLIVTVNGSGAALEAIYVTLYLAYAPRETKAKMVKVVLAVNVGALAAVVAVALVAL
HGGVRLFVVGVLCAALTIGMYAAPMAAMRTVVKTRSVEYMPFSLSFFLFLNGGVWSVYSL
LVKDYFIGIPNAIGFALGTAQLALYMAYRRTKKPAGKGGDDDEDDEEAQGVARLMGHQVE
MAQQRRDQQLRKGLSLSLPKPAAPLHGGLDRIIKSFSTTPIELHSILHQHHGGHHHHHRF
DTVPDDDDEAVAAGGTTPATTAGPGDRH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: Q10LN5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: Q10LN5_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.1% favored 3.8% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: Q10LN5_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.5% favored 4.4% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: Q10LN5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 5.5% allowed 1.6% week .5% disallowed
Gene Informationback to top
Gene ID: 4332795 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005887 - integral component of plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA