Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : Q03B62
dbSWEET id: dbswt_1876
Accession: Q03B62
Uniprot status: Unreviewed
Organism: Lactobacillus casei
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 101
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|Q03B62|Q03B62_LACC3|Unreviewed|Lactobacillus casei| 101
MRVDTGKYPEGVDPVRVKRLKLLSKVATFTCILMYVSYIPEIIANFSGNPVNPIQPLVAM
INATLWTFYGWTKTYKDWPIIISNMPGILFGLVTFITVFIH
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 24 Model end: 100 Inward Open: Template: 4X5M.pdb Model structure: Q03B62_inward.pdb Alignment file: Q03B62_inw.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 6.2% allowed 1.6% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: Q03B62_outward.pdb Alignment file: Q03B62_out.pir Procheck score ⇒ Ramachandran plot: 86.7% favored 8.6% allowed 3.1% week 1.6% disallowed Occluded: Model structure: Q03B62_occluded.pdb Alignment file: Q03B62_occ.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 7.0% allowed 2.3% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA