Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : Q03B62

dbSWEET id: dbswt_1876

Accession:   Q03B62

Uniprot status:   Unreviewed

Organism:   Lactobacillus casei

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   101

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|Q03B62|Q03B62_LACC3|Unreviewed|Lactobacillus casei| 101
MRVDTGKYPEGVDPVRVKRLKLLSKVATFTCILMYVSYIPEIIANFSGNPVNPIQPLVAM
INATLWTFYGWTKTYKDWPIIISNMPGILFGLVTFITVFIH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   24     Model end:   100

Inward Open:

Template:   4X5M.pdb

Model structure:  Q03B62_inward.pdb    Alignment file: Q03B62_inw.pir

Procheck score ⇒ Ramachandran plot: 90.6% favored    6.2% allowed    1.6% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  Q03B62_outward.pdb    Alignment file: Q03B62_out.pir

Procheck score ⇒ Ramachandran plot: 86.7% favored    8.6% allowed    3.1% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  Q03B62_occluded.pdb    Alignment file: Q03B62_occ.pir

Procheck score ⇒ Ramachandran plot: 90.6% favored    7.0% allowed    2.3% week    .0% disallowed

Gene Informationback to top


Gene ID:   4421505

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur