Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : P92011

dbSWEET id: dbswt_1215

Accession:   P92011

Uniprot status:   Unreviewed

Organism:   Caenorhabditis elegans

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.

Sequence Information back to top


Sequence length:   221

Substrate Binding Site:   QNWN           CVV:   469       CHI:   -11.4

Selectivity Filter:   FIGL           CVV:   431       CHI:   10.7

Fasta sequence:

>tr|P92011|P92011_CAEEL|Unreviewed|Caenorhabditis_elegans|221
MFLEIFRVWIGFFSISFIFLPIYLVLDWKKRGTSDGFSAVVLIIPGIIQSFWLRHGWMTN
EWTHIIINTVNLTALSFYISAYAYYQSNRKNLIGQLISAVIIVKCAFFYVDSHDAEHTNS
AMGTVAAGAQILGLGGRVYEMRRAVKLGTTEYIPAFMQFAVSALMAQWLLFGIVTGNQFI
ANANVAGLTASAITLYLYFKYPPLTWTVPLFNIPPQNAKKE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   203

Alignment file: P92011.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  P92011_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    6.0% allowed    .5% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  P92011_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    6.6% allowed    .0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  P92011_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    7.1% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Gene ID:   187765     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018175: SWEET_nem. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF4:

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur