| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : P92011
dbSWEET id: dbswt_1215
Accession: P92011
Uniprot status: Unreviewed
Organism: Caenorhabditis elegans
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.
Sequence Information back to top
Sequence length: 221
Substrate Binding Site: QNWN CVV: 469 CHI: -11.4
Selectivity Filter: FIGL CVV: 431 CHI: 10.7
Fasta sequence:
>tr|P92011|P92011_CAEEL|Unreviewed|Caenorhabditis_elegans|221
MFLEIFRVWIGFFSISFIFLPIYLVLDWKKRGTSDGFSAVVLIIPGIIQSFWLRHGWMTN
EWTHIIINTVNLTALSFYISAYAYYQSNRKNLIGQLISAVIIVKCAFFYVDSHDAEHTNS
AMGTVAAGAQILGLGGRVYEMRRAVKLGTTEYIPAFMQFAVSALMAQWLLFGIVTGNQFI
ANANVAGLTASAITLYLYFKYPPLTWTVPLFNIPPQNAKKE
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 203
Alignment file: P92011.pir
Inward Open:
Template: 5CTG.pdb
Model structure: P92011_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.8% favored 6.0% allowed .5% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: P92011_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 6.6% allowed .0% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: P92011_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.2% favored 7.1% allowed 1.6% week .0% disallowed
Gene Informationback to top
Gene ID: 187765 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number





Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018175: SWEET_nem. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF4: