| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : P0DKJ5
dbSWEET id: dbswt_139
Accession: P0DKJ5
Uniprot status: Reviewed
Organism: Vitis vinifera
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ Vitales ⇒ Vitaceae ⇒ Vitis.
Sequence Information back to top
Sequence length: 289
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>sp|P0DKJ5|SWT15_VITVI|Reviewed|Vitis_vinifera|289
MAMAMANHHTLGLIFGILGNIISFLVYFAPAPTFYRIYKRKSAEGFHSLPYIVALFSAML
WLYYALLKKDAFLLITINSFGCAIESFYILLYFFYAPMQAKKQTLKVVISLNVGVFSILV
VLIQFLLKGSNRINVFGWICASFSVAVFAAPLSIVAKVIRTKSVEFMPFSLSFFLTLSAI
MWFAYGLLKNDPCVAIPNILGVILGLVQMVLYGFYRNAGKEKMEKKLPEHIIDMVMLSTL
GTSDIHPIGAQQNGIKKSGSEDVKDDEETGNREKSTENSGELQPNGSTV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 217
Alignment file: P0DKJ5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: P0DKJ5_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.8% favored 3.2% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: P0DKJ5_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.3% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: P0DKJ5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 4.7% allowed .5% week 1.6% disallowed
Gene Informationback to top
Gene ID: 100243643 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22