Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : P0DKJ4

dbSWEET id: dbswt_604

Accession:   P0DKJ4

Uniprot status:   Reviewed

Organism:   Sorghum bicolor

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Andropogonodae ⇒ Andropogoneae ⇒ Sorghinae ⇒ Sorghum.

Sequence Information back to top


Sequence length:   243

Substrate Binding Site:   CNFN           CVV:   413       CHI:   -1.7

Selectivity Filter:   LNMM           CVV:   468       CHI:   4.1

Fasta sequence:

>sp|P0DKJ4|SWT2A_SORBI|Reviewed|Sorghum_bicolor|243
MDWAAPALTSFVADSSYRHLCCYGAGIAGNVFAFVLFISPLPTFKRIVRNGSTEQFSAMP
YIYSLLNCLICMWYGLPFVSYGVVLVATVNSIGAVFQLAYTAVFIAFADAKQRLKVSALL
AAVFVVFGLIVFVSLALLDHPTRQMFVGYLSVASLIFMFASPLSIINLVIRTKSVEYMPF
YLSLSMFLMSASFFGYGVLLNDFFIYIPNGIGTILGIIQLVLYAYFRKGSSEEAKLPLLV
THT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   15     Model end:   228

Alignment file: P0DKJ4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  P0DKJ4_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.8% favored    3.7% allowed    .5% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  P0DKJ4_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.8% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  P0DKJ4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    6.3% allowed    .5% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur