Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : O45102
dbSWEET id: dbswt_978
Accession: O45102
Uniprot status: Reviewed
Organism: Caenorhabditis elegans
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Rhabditoidea ⇒ Rhabditidae ⇒ Peloderinae ⇒ Caenorhabditis.
Sequence Information back to top
Sequence length: 299
Substrate Binding Site: GNWN CVV: 403 CHI: -8.3
Selectivity Filter: LGNV CVV: 373 CHI: 4.1
Fasta sequence:
>sp|O45102|SWET1_CAEEL|Reviewed|Caenorhabditis_elegans|299
MLEVVLQVLSISAITTTIALFFCGIPICMQIRRQGAVGDISGVPFLMGVLGGSFWLRYGL
LKMDYVMIIVNVVGVACMAFYCVFFLIYSLPKKTFTCQLILVTSTIGGMVLWIALKPNLD
YLGVICMTFNIMNFGAPLAGLGVVLKNREVSTLPLPMCVANFLVSSQWCLYGNLVSDIYI
IIPNGIGMFLAIVQLALFVVLPIRENEKSPLEKLASWFTGRDSKVKDLERGDCIVSSPPS
SPQKVPNETRSDVEDKFDKLMAETSSTIPSDSRRGSMGSPPSYKSRSSSDPDLSSIQSP
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 203
Alignment file: O45102.pir
Inward Open:
Template: 5CTG.pdb
Model structure: O45102_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.2% allowed .6% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: O45102_outward.pdb
Procheck score ⇒ Ramachandran plot: 89.1% favored 9.8% allowed .6% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: O45102_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.2% favored 7.5% allowed 1.7% week .6% disallowed
Gene Informationback to top
Gene ID: 186875 Total Exons: 7 Coding Exons: 7
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0005794 - Golgi apparatus
GO:0000139 - Golgi membrane
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA