Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : N6UNU8
dbSWEET id: dbswt_1297
Accession: N6UNU8
Uniprot status: Unreviewed
Organism: Dendroctonus ponderosae
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Coleoptera ⇒ Polyphaga ⇒ Cucujiformia ⇒ Curculionidae ⇒ Scolytinae ⇒ Dendroctonus.
Sequence Information back to top
Sequence length: 450
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: QSFV CVV: 427 CHI: 2.7
Fasta sequence:
>tr|N6UNU8|N6UNU8_DENPD|Unreviewed|Dendroctonus_ponderosae|450
MLDEQLKNLLATTASISTVLQFLSGTITCQRIVRNKSTGEISAFPFVSGCLSTALWLRYG
FLIQDTSIILVNTIGVSLFFSYVLVLFLYSIKKVIQVLRQFLLSLGLLVAVLMKLHRMED
GAQAHQFLGYTCMAVTVLFFAAPFATLLQVIRSKSTDSLPYHLIVATFLVSLQWLIYGLM
LQDPFIQAPNFLGCVLSGLQLSLFLIYPAKAHGASPRQPLAALPQCPPHSYRSMTDDSKI
MGEVAQPRFEKSLGLLTSKFVSLLQKSKGGILDLKVAADILEVRQKRRIYDITNVLEGIG
LIEKKSKNSIQWKPYTVYRPASNAEDANSGGFTEKISRLKQKLARLDEYEHELDMHKIWI
NQSIRNTTEGNSQFLYLTLEDFAACYGQQDAVIAAKVPVNETRVAVSNNEGSFSLKIAST
GRPIDAYLVSERVLDGRQAGAPQAPPLHQP
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 209
Alignment file: N6UNU8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: N6UNU8_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 7.4% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: N6UNU8_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 6.8% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: N6UNU8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.1% favored 6.8% allowed 1.6% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005634 - nucleus
GO:0005667 - transcription factor complex
GO:0003677 - DNA binding
GO:0003700 - transcription factor activity sequence-specific DNA binding
GO:0008643 - carbohydrate transport
GO:0006351 - transcription DNA-templated