| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : N1ZSK9
dbSWEET id: dbswt_1874
Accession: N1ZSK9
Uniprot status: Unreviewed
Organism: Lactobacillus murinus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 89
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|N1ZSK9|N1ZSK9_9LACO|Unreviewed|Lactobacillus murinus|89
MKNTDSKVILMLGRIGSVLSVIMYVSYIPQIMNNLNGNYGSPIQPLVAGINCTIWVIYSY
FKSQRDWPIFIANLPGVFLGFITFYTSLH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 13 Model end: 89 Inward Open: Template: 4X5M.pdb Model structure: N1ZSK9_inward.pdb Alignment file: N1ZSK9_inw.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 9.5% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: N1ZSK9_outward.pdb Alignment file: N1ZSK9_out.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.1% allowed .0% week .8% disallowed Occluded: Model structure: N1ZSK9_occluded.pdb Alignment file: N1ZSK9_occ.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 6.3% allowed 1.6% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA