Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : N1ZSK9

dbSWEET id: dbswt_1874

Accession:   N1ZSK9

Uniprot status:   Unreviewed

Organism:   Lactobacillus murinus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   89

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|N1ZSK9|N1ZSK9_9LACO|Unreviewed|Lactobacillus murinus|89
MKNTDSKVILMLGRIGSVLSVIMYVSYIPQIMNNLNGNYGSPIQPLVAGINCTIWVIYSY
FKSQRDWPIFIANLPGVFLGFITFYTSLH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   13     Model end:   89

Inward Open:

Template:   4X5M.pdb

Model structure:  N1ZSK9_inward.pdb    Alignment file: N1ZSK9_inw.pir

Procheck score ⇒ Ramachandran plot: 89.7% favored    9.5% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  N1ZSK9_outward.pdb    Alignment file: N1ZSK9_out.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.1% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  N1ZSK9_occluded.pdb    Alignment file: N1ZSK9_occ.pir

Procheck score ⇒ Ramachandran plot: 90.5% favored    6.3% allowed    1.6% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur