| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : N1WJW5
dbSWEET id: dbswt_1873
Accession: N1WJW5
Uniprot status: Unreviewed
Organism: Leptospira weilii
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|N1WJW5|N1WJW5_9LEPT|Unreviewed|Leptospira weilii|88
MDSITFLGYIASLLTTVSFLPQLIRIVMGGSTKDISRNMYIVLVVGVFLWLIYGCFKQDF
PIILANTFTFIFTSIILFFKLREDSRNK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: N1WJW5_inward.pdb Alignment file: N1WJW5_inw.pir Procheck score ⇒ Ramachandran plot: 95.6% favored 2.9% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: N1WJW5_outward.pdb Alignment file: N1WJW5_out.pir Procheck score ⇒ Ramachandran plot: 94.1% favored 5.9% allowed .0% week .0% disallowed Occluded: Model structure: N1WJW5_occluded.pdb Alignment file: N1WJW5_occ.pir Procheck score ⇒ Ramachandran plot: 99.3% favored .7% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA