Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : M8C956
dbSWEET id: dbswt_51
Accession: M8C956
Uniprot status: Unreviewed
Organism: Aegilops tauschii
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Aegilops.
Sequence Information back to top
Sequence length: 287
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|M8C956|M8C956_AEGTA|Unreviewed|Aegilops_tauschii|287
MAEGLFSMAHPWASAFGILGNIISFLVFLAPTPTFLRVYRKKSTEGFSAVPYVVALFSCM
LWIFYALVKTNSSPLLTINAFGCVVEGFYILLYVVYAPRHARHRALAFFLLLDVAAFALI
VAVTVFLVPQPSRVKVLGSVCLAFSMAVFVAPLSVIFVVIKTKSAEYMPFSLSFFLTLSA
VAWFFYGLFTKDIYVTLPNVGGFFFGVAQMTLYFCYRKPDTSALVLPTGIHDVSTEPAAQ
QEVELPEGTHPAVAMLTVSTLPMLAELQKMEQEISSPTPRKGYIKAF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 6 Model end: 218
Alignment file: M8C956.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M8C956_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 5.8% allowed .0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M8C956_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 5.8% allowed 2.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M8C956_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 4.2% allowed 1.6% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA