| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M8C2Z8
dbSWEET id: dbswt_72
Accession: M8C2Z8
Uniprot status: Unreviewed
Organism: Aegilops tauschii
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Aegilops.
Sequence Information back to top
Sequence length: 275
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|M8C2Z8|M8C2Z8_AEGTA|Unreviewed|Aegilops_tauschii|275
MAGGLFDMSHPASALAGIAGNIVSFFVFLAPMATFLQIYRKKTTGGFSSVPYVVALFSCS
LLIFYALLKTDSPLLLTINSFGCCIETVYIVAYLVYAPPRARLRTLAYFFVLDVAAFGLV
LVVTMYAFAPAHRVKFLGSVCLAFSMAVFVAPLSIIVKVIKTKSVEFLPVGLSFCLVLSA
VAWFCYGLFTKDPFVMYPNVGGFFFSCVQIGLYCWYRKPSNAVLPTTTADAGNGNGGPTP
AAGAEQQTVIDVKDAARAAEVDQPEVIEIVPAPAV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 6 Model end: 218
Alignment file: M8C2Z8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M8C2Z8_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.8% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M8C2Z8_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.3% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M8C2Z8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.5% favored 6.4% allowed .5% week .5% disallowed
Gene Ontologyback to top
GO:0005887 - integral component of plasma membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0006825 - copper ion transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA