| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M8C170
dbSWEET id: dbswt_321
Accession: M8C170
Uniprot status: Unreviewed
Organism: Aegilops tauschii
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Aegilops.
Sequence Information back to top
Sequence length: 237
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|M8C170|M8C170_AEGTA|Unreviewed|Aegilops_tauschii|237
MGAVGSPLVFAVGILGNILSFLVILAPVPTFYRVYKRKSTESFQSVPYAMALLSAMLWLY
YALLTKDLLLLTINTVGCVVESAYLAIYLAYAPKQARTFTAKLVCIMNVALYGAMVCVLQ
LLVKDGESRVTIAGGIGSAFALAVFVAPLAIIRQVIRTKSVEFLPFWLSFFLTISAVVWF
FYGLLMKDFFVATPNVLGLLFGLAQMSLHLVYKNPKKKGAVSEVQYSIGLLVWARLI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 214
Alignment file: M8C170.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M8C170_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 5.8% allowed 2.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M8C170_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 5.3% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M8C170_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.7% allowed 1.1% week .0% disallowed
Gene Ontologyback to top
GO:0005887 - integral component of plasma membrane
GO:0032588 - trans-Golgi network membrane
GO:0012506 - vesicle membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0071836 - nectar secretion
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA