| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M8BAN7
dbSWEET id: dbswt_343
Accession: M8BAN7
Uniprot status: Unreviewed
Organism: Aegilops tauschii
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Aegilops.
Sequence Information back to top
Sequence length: 285
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: SSVS CVV: 324 CHI: 1.8
Fasta sequence:
>tr|M8BAN7|M8BAN7_AEGTA|Unreviewed|Aegilops_tauschii|285
MAGLSLEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW
IFYALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNVAGFGLILL
LTLFAFHGETRVISLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAVV
WFLYGLLIKDKYVALPNILGFTFGMIQMVLYMFYMNATPVVSDLKEGKEGLKMSAEEHVV
VINVGKSEKSSGAVVRPVTEMVKAVPAAPGQQVMALDSARSVDVV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 216
Alignment file: M8BAN7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M8BAN7_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 3.7% allowed 2.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M8BAN7_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.8% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M8BAN7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 7.5% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA