Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M8A0W3

dbSWEET id: dbswt_483

Accession:   M8A0W3

Uniprot status:   Unreviewed

Organism:   Triticum urartu

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Triticum.

Sequence Information back to top


Sequence length:   262

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   VNMN           CVV:   421       CHI:   -0.9

Fasta sequence:

>tr|M8A0W3|M8A0W3_TRIUA|Unreviewed|Triticum_urartu|262
MNSTLFIIGIIGNIISVLVFVSPIPTFWRIVRSRSTEDFEAAPYVLTLLNTLLWLYYGLT
KPDGLLIATVNGFGAVMETIYIVLFLVYAADHAKRVKTTKLVAALDIGFFGVVFATTTFA
IRGLDMKIVVIGLICACLSVFMYGSPLAAVRRVIASRSVEYMPFFLSFFLFLNGGVWAMY
AILDKDVFLGVPNGIGCFLGGIQLVIYAVYRNKQPAKSLVTRLQAKSGTPSAHTVEDASS
RLAPNVLKNQLLYYKPVGNAKY

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   212

Alignment file: M8A0W3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M8A0W3_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    6.5% allowed    .5% week    2.2% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M8A0W3_outward.pdb

Procheck score ⇒ Ramachandran plot: 96.7% favored    2.7% allowed    .0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M8A0W3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    4.9% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur