| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M7Z8F5
dbSWEET id: dbswt_439
Accession: M7Z8F5
Uniprot status: Unreviewed
Organism: Triticum urartu
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Triticum.
Sequence Information back to top
Sequence length: 351
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: VCMN CVV: 411 CHI: 5.1
Fasta sequence:
>tr|M7Z8F5|M7Z8F5_TRIUA|Unreviewed|Triticum_urartu|351
MADPSFFVGIIGNIISILVFTSPMVVRNKSTEEFRWLPYVTTLLCTSLWAFYGLLKPGGL
LIITVNAAGAALQATYVALYLAYAPRDTKVKMAKVVVGVNICFFAAVVVVGLVALHGAVR
LFAVGVLCSALTIAMYAAPMVAMRTVVKTRSVEYMPFSLSFFLFLNGGIWSVYSLLVKDY
FIGIPNAMGFVMGTAQLALYMAYRNKKKLVALKEEDEEKGAVHLMGQVELGQAKVPSLKK
GLSLPMPSSLPSPLHGFGNLIKALSATPLELHSVLSQHERVGAKEEHHDDDDDDDDEHAY
SSKSPGSALGGHEPMNVTNHTAARRDGKRFADVVVVLHSETSWNASGIVQV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 205
Alignment file: M7Z8F5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M7Z8F5_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 5.0% allowed 1.7% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M7Z8F5_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.5% favored 6.7% allowed 1.1% week 1.7% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M7Z8F5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 6.1% allowed 1.1% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA