| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M7Z3G1
dbSWEET id: dbswt_596
Accession: M7Z3G1
Uniprot status: Unreviewed
Organism: Triticum urartu
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Triticum.
Sequence Information back to top
Sequence length: 231
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|M7Z3G1|M7Z3G1_TRIUA|Unreviewed|Triticum_urartu|231
MDSLSLYEISCFAAGFAGNLFAFALFLSPVPTFKRILKAKSTEQFDGLPYLLSLLNCFIC
LWYGLPWVSDGRLLVATVNGTGAAFQLAYISLFFIYADSRKTRLRMVGLLTLLVCAFALV
AHASIAFFDQPTRQQFVGAVSMASLLSMFASPLAVMGVVIRTECVEFMPFYLSLSTLLMS
ASFAVYGVLLRDLFIYLPNGLGVVLGATQLALYAYYSRKWRCKDTSAPLLA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 218
Alignment file: M7Z3G1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M7Z3G1_inward.pdb
Procheck score ⇒ Ramachandran plot: 96.3% favored 2.1% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M7Z3G1_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 4.7% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M7Z3G1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 7.4% allowed 1.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA