| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M7Z127
dbSWEET id: dbswt_947
Accession: M7Z127
Uniprot status: Unreviewed
Organism: Triticum urartu
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Triticum.
Sequence Information back to top
Sequence length: 246
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|M7Z127|M7Z127_TRIUA|Unreviewed|Triticum_urartu|246
MVSAEVARNIVGIIGNVISFGLFLSPVPTFWRIYKAKDVEEFKPDPYLATLMNCLLWFFY
GLPIVHPNSTLVLTINGIGLVIEGTYIIIFIIYAAKNTRWKMLGVLALEAAFMAVVVAGV
LLGAHTHEKRSMIVGILCVIFGSIMYASPLTIMGKVIRTKSVEYMPFFLSLVNFLNGCCW
MGYALIKFDIYITIPNALGTIFGLIQLILYFYYYRLSPKKGKNVELPTVLTKNAVTSGNV
SVTIEK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: M7Z127.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M7Z127_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.3% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M7Z127_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 7.5% allowed .0% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M7Z127_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 6.5% allowed 1.1% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA