| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M7YPX9
dbSWEET id: dbswt_943
Accession: M7YPX9
Uniprot status: Unreviewed
Organism: Triticum urartu
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Pooideae ⇒ Triticodae ⇒ Triticeae ⇒ Triticinae ⇒ Triticum.
Sequence Information back to top
Sequence length: 247
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|M7YPX9|M7YPX9_TRIUA|Unreviewed|Triticum_urartu|247
MVSADAARNIIGIIGNVISFGLFLSPTPTLCRICKAKDVEEFKPDPYLATLLNCMLWVFY
GLPIVHPNSILVATINGIGLVIEGAYLIIFLIYSTNNKRLKMLGVLAAEAVFMVCVVIGV
LLGAHTHEKRSMIVGILCVIFGSIMYASPLTIMGKVIRTKSVEYMPFFLSLVNFLNGCCW
TAYALIKFDLYVTIPNGLGAFFGLVQLILYACYYKSTPKKEKNVELPNAINNNISGGSDN
VSVTVER
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: M7YPX9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M7YPX9_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.3% allowed .0% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M7YPX9_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 5.4% allowed .0% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M7YPX9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 5.4% allowed 1.6% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA