Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M6UG27

dbSWEET id: dbswt_1868

Accession:   M6UG27

Uniprot status:   Unreviewed

Organism:   Leptospira noguchii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Spirochaetes ⇒ Leptospirales ⇒ Leptospiraceae ⇒ Leptospira.

Sequence Information back to top


Sequence length:   90

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|M6UG27|M6UG27_9LEPT|Unreviewed|Leptospira noguchii|90
MDSITFLGYIASLLTTISFLPQVIRILMGESTKDISRNMYIVLVTGVFLWFIYGCLKQDF
PIILANAFTFLFAGTILYFKLRNDSKESKK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  M6UG27_inward.pdb    Alignment file: M6UG27_inw.pir

Procheck score ⇒ Ramachandran plot: 95.6% favored    1.5% allowed    2.9% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  M6UG27_outward.pdb    Alignment file: M6UG27_out.pir

Procheck score ⇒ Ramachandran plot: 94.9% favored    5.1% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  M6UG27_occluded.pdb    Alignment file: M6UG27_occ.pir

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.7% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur