Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M6DD04

dbSWEET id: dbswt_1867

Accession:   M6DD04

Uniprot status:   Unreviewed

Organism:   Leptospira

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Spirochaetes ⇒ Leptospirales ⇒ Leptospiraceae ⇒ Leptospira.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   AGAG           CVV:   230       CHI:   2.8

Fasta sequence:

>tr|M6DD04|M6DD04_9LEPT|Unreviewed|Leptospira|88
MMDPISLLGFIACTLTTLAFLPQLIKVILEKRTRDISRNMYLVLSVGVFFWLCYGVLKND
FPIILANSFTLLFTTTILWYKLRSKEEE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   6     Model end:   83

Inward Open:

Template:   4X5M.pdb

Model structure:  M6DD04_inward.pdb    Alignment file: M6DD04_inw.pir

Procheck score ⇒ Ramachandran plot: 93.6% favored    5.7% allowed    .7% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  M6DD04_outward.pdb    Alignment file: M6DD04_out.pir

Procheck score ⇒ Ramachandran plot: 90.7% favored    9.3% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  M6DD04_occluded.pdb    Alignment file: M6DD04_occ.pir

Procheck score ⇒ Ramachandran plot: 97.9% favored    2.1% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur