| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M6CVI7
dbSWEET id: dbswt_1866
Accession: M6CVI7
Uniprot status: Unreviewed
Organism: Leptospira alstonii
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 90
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|M6CVI7|M6CVI7_9LEPT|Unreviewed|Leptospira alstonii|90
MNMDSITFLGYIASLLTTVSFLPQLIRIVMGGSTKDISRNMYIVFVTGVVLWFVYGCLKQ
DFPIILANIFTFIFTSIILYFKLRNDAKGE
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 7 Model end: 84 Inward Open: Template: 4X5M.pdb Model structure: M6CVI7_inward.pdb Alignment file: M6CVI7_inw.pir Procheck score ⇒ Ramachandran plot: 95.6% favored 2.9% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: M6CVI7_outward.pdb Alignment file: M6CVI7_out.pir Procheck score ⇒ Ramachandran plot: 92.6% favored 7.4% allowed .0% week .0% disallowed Occluded: Model structure: M6CVI7_occluded.pdb Alignment file: M6CVI7_occ.pir Procheck score ⇒ Ramachandran plot: 97.1% favored 2.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA