Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : M6C717
dbSWEET id: dbswt_1865
Accession: M6C717
Uniprot status: Unreviewed
Organism: Leptospira meyeri
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|M6C717|M6C717_LEPME|Unreviewed|Leptospira meyeri|85
MENLIGYIAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFVGVLLWFVYGVLKSDFPI
ILANAVTIFFVSIILYYKLKTEEDI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 80 Inward Open: Template: 4X5M.pdb Model structure: M6C717_inward.pdb Alignment file: M6C717_inw.pir Procheck score ⇒ Ramachandran plot: 94.3% favored 5.0% allowed .7% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: M6C717_outward.pdb Alignment file: M6C717_out.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.1% allowed .7% week .0% disallowed Occluded: Model structure: M6C717_occluded.pdb Alignment file: M6C717_occ.pir Procheck score ⇒ Ramachandran plot: 97.1% favored 2.9% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA