Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : M5Y9I2
dbSWEET id: dbswt_493
Accession: M5Y9I2
Uniprot status: Unreviewed
Organism: Prunus persica
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Rosaceae ⇒ Maloideae ⇒ Amygdaleae ⇒ Prunus.
Sequence Information back to top
Sequence length: 251
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: MNMN CVV: 440 CHI: -3.2
Fasta sequence:
>tr|M5Y9I2|M5Y9I2_PRUPE|Unreviewed|Prunus_persica|251
MEGLIIFIGVIGNIISVLMFLAPVGTFWRIVKHRSTEDFESLPYVCTFLNSFLWTYYGII
RPAGGLLVATVNGFGVVVEIIYLILFLVYAPAKMRAKTAILIGTLDVGFLVAAILATWLA
LQGETRIDALGFICAGLNIIMYGSPLVAMKTVITTKSVEYMPFFLSFFFFLNGGVWTLYA
WLIRDVFLGVPNGIGFLLGTTQLVLYAIYRNAKPADNISSGLLEEGRQHEPLISPSSATP
SQKNGEILETT
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: M5Y9I2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M5Y9I2_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.9% favored 3.3% allowed 1.7% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M5Y9I2_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.6% favored 3.3% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M5Y9I2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.9% favored 3.3% allowed 2.2% week .6% disallowed
Gene Informationback to top
Gene ID: 18793444 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA