Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M5XQ65

dbSWEET id: dbswt_138

Accession:   M5XQ65

Uniprot status:   Unreviewed

Organism:   Prunus persica

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Rosaceae ⇒ Maloideae ⇒ Amygdaleae ⇒ Prunus.

Sequence Information back to top


Sequence length:   277

Substrate Binding Site:   GNWN           CVV:   403       CHI:   -8.3

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|M5XQ65|M5XQ65_PRUPE|Unreviewed|Prunus_persica|277
MGALADSHHPWAFTFGILGNVISFLVYLAPVPTFYGIYKKKSTQGFQSVPYLVALFSGML
WFYYALLKKNAMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSIL
VLSHFAVRSEYRVPVLGWINVAISVIVFAAPLSIVAQVIRTRSVEFMPFSLSFFLTLSAV
MWFSYGLFLKDICIAIPNVLGFILGLLQMLLYAIYRNRKPIEDDEKKIPAADQHVKNVVG
LTTLATSEVHPVDPPPRDHDKSVEVDAGSHTAAASCA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   217

Alignment file: M5XQ65.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M5XQ65_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    6.9% allowed    1.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M5XQ65_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    6.3% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M5XQ65_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    4.8% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Gene ID:   18793807     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0005887 - integral component of plasma membrane

GO:0008515 - sucrose transmembrane transporter activity

GO:0071470 - cellular response to osmotic stress

GO:0010150 - leaf senescence

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur