| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M5XQ65
dbSWEET id: dbswt_138
Accession: M5XQ65
Uniprot status: Unreviewed
Organism: Prunus persica
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Rosaceae ⇒ Maloideae ⇒ Amygdaleae ⇒ Prunus.
Sequence Information back to top
Sequence length: 277
Substrate Binding Site: GNWN CVV: 403 CHI: -8.3
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|M5XQ65|M5XQ65_PRUPE|Unreviewed|Prunus_persica|277
MGALADSHHPWAFTFGILGNVISFLVYLAPVPTFYGIYKKKSTQGFQSVPYLVALFSGML
WFYYALLKKNAMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSIL
VLSHFAVRSEYRVPVLGWINVAISVIVFAAPLSIVAQVIRTRSVEFMPFSLSFFLTLSAV
MWFSYGLFLKDICIAIPNVLGFILGLLQMLLYAIYRNRKPIEDDEKKIPAADQHVKNVVG
LTTLATSEVHPVDPPPRDHDKSVEVDAGSHTAAASCA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 217
Alignment file: M5XQ65.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M5XQ65_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 6.9% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M5XQ65_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M5XQ65_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 4.8% allowed 1.6% week .5% disallowed
Gene Informationback to top
Gene ID: 18793807 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0005887 - integral component of plasma membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0071470 - cellular response to osmotic stress
GO:0010150 - leaf senescence
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA