Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : M5X251
dbSWEET id: dbswt_669
Accession: M5X251
Uniprot status: Unreviewed
Organism: Prunus persica
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Rosaceae ⇒ Maloideae ⇒ Amygdaleae ⇒ Prunus.
Sequence Information back to top
Sequence length: 235
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|M5X251|M5X251_PRUPE|Unreviewed|Prunus_persica|235
MLSTGLSSVYLGFSTAAGIAGNIFAFVLFVSPLPTFKRIIRNKSTEQFSGLPYIYAFLNC
LICLWYGMPVVKTGIILVATVNSFGAVFQLVYLSIFITYAERATKLRMLGLLGAVAVVFA
FVVFVSLGVLEYDDRQTFVGYLSVASLISMFASPLFIIKLVIKTRSVEFMPFNLSFATFL
MSLSFSAYGIFKEDPFLYIPNGIGTILGLVQLALYSYYSKISGEDSREPLIVSYV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 7 Model end: 220
Alignment file: M5X251.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M5X251_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 3.7% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M5X251_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.8% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M5X251_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.6% favored 5.9% allowed .5% week .0% disallowed
Gene Informationback to top
Gene ID: 18780140 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA