Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : M5WK62
dbSWEET id: dbswt_657
Accession: M5WK62
Uniprot status: Unreviewed
Organism: Prunus persica
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Rosaceae ⇒ Maloideae ⇒ Amygdaleae ⇒ Prunus.
Sequence Information back to top
Sequence length: 241
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|M5WK62|M5WK62_PRUPE|Unreviewed|Prunus_persica|241
LELKALMVFSASHSVFIICRDAAGIAGNIFAFGLFLSPIHTYRRIIRNRSTEEFSGLPYI
YALLNCLICTWYGSPLVSSDNLLIMTVNSAGAVFQLVYIALFIIYAEKSKKVRMLGFLLA
DFGLFAIIVFGSLQMTDLVMRRLIVGLLSCVSLISMFASPMFIINLVIRTKSVEFMPFYL
SLSTFLMSTSFFLYGIFNYDLFIYVPNGIGTILGIIQLALYFYYKDSSKEDSREPLIVPY
P
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 13 Model end: 226
Alignment file: M5WK62.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M5WK62_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.2% allowed 1.6% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M5WK62_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 5.2% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M5WK62_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 7.3% allowed .5% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA