Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M5WK62

dbSWEET id: dbswt_657

Accession:   M5WK62

Uniprot status:   Unreviewed

Organism:   Prunus persica

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Rosaceae ⇒ Maloideae ⇒ Amygdaleae ⇒ Prunus.

Sequence Information back to top


Sequence length:   241

Substrate Binding Site:   CNFN           CVV:   413       CHI:   -1.7

Selectivity Filter:   LNMM           CVV:   468       CHI:   4.1

Fasta sequence:

>tr|M5WK62|M5WK62_PRUPE|Unreviewed|Prunus_persica|241
LELKALMVFSASHSVFIICRDAAGIAGNIFAFGLFLSPIHTYRRIIRNRSTEEFSGLPYI
YALLNCLICTWYGSPLVSSDNLLIMTVNSAGAVFQLVYIALFIIYAEKSKKVRMLGFLLA
DFGLFAIIVFGSLQMTDLVMRRLIVGLLSCVSLISMFASPMFIINLVIRTKSVEFMPFYL
SLSTFLMSTSFFLYGIFNYDLFIYVPNGIGTILGIIQLALYFYYKDSSKEDSREPLIVPY
P

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   13     Model end:   226

Alignment file: M5WK62.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M5WK62_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.2% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M5WK62_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.7% favored    5.2% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M5WK62_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.3% allowed    .5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur