Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M5WBD1

dbSWEET id: dbswt_159

Accession:   M5WBD1

Uniprot status:   Unreviewed

Organism:   Prunus persica

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Rosaceae ⇒ Maloideae ⇒ Amygdaleae ⇒ Prunus.

Sequence Information back to top


Sequence length:   293

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   VSVG           CVV:   331       CHI:   7.2

Fasta sequence:

>tr|M5WBD1|M5WBD1_PRUPE|Unreviewed|Prunus_persica|293
MAIQHPLTLSFGLLGNIISFLVFLAPVPTFYTIYKRKTAEGFQALPYVIALLSSMLYIYY
ALLKEEFKEDATFLITINSFGCVVETLYISLFLFYAPKKARISTLTLVFLLNLFGFGLMM
LLTHFLATGEMRLKIVGWICLVFSLSVFVAPLGVLRRVIRTKSVEFMPFPLSFFLTLGAV
TWFFYGLLIKDYNIAFPNILGFLFGIAQMVLYIVYKNTKKVLEEQPKVQELSEHIIDVVK
ISSLVCPELNPVVLQPTLDITNDMIEAVQNIIVMAEKTEEAKEAMDIDASTKV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   217

Alignment file: M5WBD1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M5WBD1_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.2% allowed    .5% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M5WBD1_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    7.3% allowed    1.0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M5WBD1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    5.7% allowed    2.6% week    .5% disallowed

Gene Informationback to top


Gene ID:   18777591     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur