Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M5VZU0

dbSWEET id: dbswt_238

Accession:   M5VZU0

Uniprot status:   Unreviewed

Organism:   Prunus persica

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Rosaceae ⇒ Maloideae ⇒ Amygdaleae ⇒ Prunus.

Sequence Information back to top


Sequence length:   244

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVC           CVV:   369       CHI:   10.1

Fasta sequence:

>tr|M5VZU0|M5VZU0_PRUPE|Unreviewed|Prunus_persica|244
MKFLSNEQLAFVFGLLGNIVSFMVFLAPIPTFYTIYKKKSSKGFQSIPYVVALLSAMLLL
YYGVLKTNAFLIISINGIGCVIEIIYLIFYIVHASKKDKITTMSLILLVNVAAFGLVMAV
TLFLLGEAKRVSAVGWMCAVFNIAVFAAPLSIVRQVIRTKSVEYMPFSLSFFLTLCATMW
FFYGLFTKDYYIALPNVLGFLLGVAQMILYLKYKNSGKNDAENKGSQEMKKFHEPQPPEA
DAQC

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   215

Alignment file: M5VZU0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M5VZU0_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.7% favored    7.3% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M5VZU0_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    5.7% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M5VZU0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.7% favored    7.3% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   18772248     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0032588 - trans-Golgi network membrane

GO:0012506 - vesicle membrane

GO:0008515 - sucrose transmembrane transporter activity

GO:0071836 - nectar secretion

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur