Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M5VKV8

dbSWEET id: dbswt_732

Accession:   M5VKV8

Uniprot status:   Unreviewed

Organism:   Prunus persica

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Rosaceae ⇒ Maloideae ⇒ Amygdaleae ⇒ Prunus.

Sequence Information back to top


Sequence length:   260

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMC           CVV:   430       CHI:   4.7

Fasta sequence:

>tr|M5VKV8|M5VKV8_PRUPE|Unreviewed|Prunus_persica|260
MHILKVFFGVVGNATALFLFLAPIITFKRIIQKRSTEQFSGIPYVMTMLNCLLSAWYGLP
FVSPNNILVSTINGTGAAIEAIYVLIFIIFAPKREKFKILGLFTIVLAIFSTVALVSVFA
LHSKARKLFCGLAATVFSIIMYGSPLAIMSTVIRTKSVEFMPFFLSLFSFLCGTSWFIFG
LLGHDPFVAVPNGFGSGLGALQLVLYFIYRDSSKGSTGSIKKASSSSTAATADESMEMGV
AKPHQSKQSMAISGAQDGQP

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: M5VKV8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M5VKV8_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.4% favored    4.9% allowed    .5% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M5VKV8_outward.pdb

Procheck score ⇒ Ramachandran plot: 97.3% favored    2.2% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M5VKV8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 95.6% favored    3.3% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Gene ID:   18768928     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur