| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M5VKV8
dbSWEET id: dbswt_732
Accession: M5VKV8
Uniprot status: Unreviewed
Organism: Prunus persica
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Rosales ⇒ Rosaceae ⇒ Maloideae ⇒ Amygdaleae ⇒ Prunus.
Sequence Information back to top
Sequence length: 260
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMC CVV: 430 CHI: 4.7
Fasta sequence:
>tr|M5VKV8|M5VKV8_PRUPE|Unreviewed|Prunus_persica|260
MHILKVFFGVVGNATALFLFLAPIITFKRIIQKRSTEQFSGIPYVMTMLNCLLSAWYGLP
FVSPNNILVSTINGTGAAIEAIYVLIFIIFAPKREKFKILGLFTIVLAIFSTVALVSVFA
LHSKARKLFCGLAATVFSIIMYGSPLAIMSTVIRTKSVEFMPFFLSLFSFLCGTSWFIFG
LLGHDPFVAVPNGFGSGLGALQLVLYFIYRDSSKGSTGSIKKASSSSTAATADESMEMGV
AKPHQSKQSMAISGAQDGQP
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: M5VKV8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M5VKV8_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.4% favored 4.9% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M5VKV8_outward.pdb
Procheck score ⇒ Ramachandran plot: 97.3% favored 2.2% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M5VKV8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 95.6% favored 3.3% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 18768928 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA