Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M4FHB1

dbSWEET id: dbswt_4

Accession:   M4FHB1

Uniprot status:   Unreviewed

Organism:   Brassica rapa

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.

Sequence Information back to top


Sequence length:   294

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|M4FHB1|M4FHB1_BRARP|Unreviewed|Brassica_rapa|294
MALPHNVWAFVFGIMGNIISFVVFLAPVPTFVRICKKKSTEGFQSLPYLSALFSALLWIY
YAMQKDGSGFLLITINAVGCFIETIYIVLFITYANKKTRISTLKVLGLLNFLGFAAIVLV
CELLTKGSTREKVLGGICVGFSVIVFAAPLSIMRVVIRTRSVEFMPFSLSLFLTLSAVTW
LFYGLAIKDFYVALPNVLGAFLGAVQMILYIIFKYYKTPVAEKTEKSKTVTDHSIDMTKL
TTVMPTPVSDTAVHPPLAIHDVPESQIQETEVKNQNMTSLKDQNNKDLENQNQL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   215

Alignment file: M4FHB1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M4FHB1_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.8% allowed    1.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M4FHB1_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    3.7% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M4FHB1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    5.8% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008515 - sucrose transmembrane transporter activity

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur