| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M4F479
dbSWEET id: dbswt_879
Accession: M4F479
Uniprot status: Unreviewed
Organism: Brassica rapa
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.
Sequence Information back to top
Sequence length: 240
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|M4F479|M4F479_BRARP|Unreviewed|Brassica_rapa|240
MTDAHTARTIVGIIGNVISFGLFCSPIPTMIKIWKMKSVSEFKPDPYLATVLNCMMWSFY
GLPFVHPDSLLVVTINGTGLFMELVYVTIFFIFATSAIRRKITIAMVVEMIFMAVVIFCT
LYFLHTTKQRSMLIGIMCIVFNVIMYASPLTVMRLVIKTKSVKYMPFFLSLASFMNGVVW
VIYACLKFDPYILIPNGLGSLSGLVQLILYATYYKTTNWNDEDGDKEKRFTNAEIQLDRA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: M4F479.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M4F479_inward.pdb
Procheck score ⇒ Ramachandran plot: 95.8% favored 3.1% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M4F479_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.8% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M4F479_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.7% favored 5.2% allowed 1.6% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA