| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M4F2H1
dbSWEET id: dbswt_778
Accession: M4F2H1
Uniprot status: Unreviewed
Organism: Brassica rapa
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.
Sequence Information back to top
Sequence length: 249
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|M4F2H1|M4F2H1_BRARP|Unreviewed|Brassica_rapa|249
MASAQLTIRKIVGIIGNAIALCLFLSPTPTFRRIVKKKSVEEYSPIPYLATLINCLVWVL
YGLPMVHPDSTLVVTINGAGILIEVVFITIFFVFSGRPKQRLVIAAVLAGETLFVAILSV
LVFTLQHTTKERTMSVGIVCCVFNVMMYASPLSVMKMVIRTKSVEFMPFWLSLAAFLNAG
VWTVYALMPLDPFIAIPNGIGCIFGLAQLILYATYYKSTKKMMAERQPMIGLSSVVVRIG
SEKVAQPSA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 217
Alignment file: M4F2H1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M4F2H1_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 3.7% allowed 1.1% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M4F2H1_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 6.9% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M4F2H1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.5% favored 6.3% allowed 1.6% week 1.6% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA