Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M4EKC7

dbSWEET id: dbswt_889

Accession:   M4EKC7

Uniprot status:   Unreviewed

Organism:   Brassica rapa

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.

Sequence Information back to top


Sequence length:   240

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMN           CVV:   440       CHI:   -1.3

Fasta sequence:

>tr|M4EKC7|M4EKC7_BRARP|Unreviewed|Brassica_rapa|240
MTDIKTARTIVGAIGNVIAFGLYSAPIPTMVKICKMKSVAEFKPDPYIATVINCMMWAFY
GLPFVTPDNILVITNNGVGLAMELVYVIIFFTFATSPVRKKITIAIVIEVLFMAVVVFCT
LYFLHTTKQRSMLVGILCIIFNVIMYAAPLTAMAQVIKTKSVKYMPFSLSLANFMNGAIW
IVYSCLKFDLYILIPNVLGCLSGIIQLILYAIYYKTTNWKDDDEDNENSNSNAEIEHSQA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: M4EKC7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M4EKC7_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.3% favored    3.6% allowed    1.0% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M4EKC7_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.7% favored    6.2% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M4EKC7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 95.8% favored    3.6% allowed    .0% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur