| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M4ECH7
dbSWEET id: dbswt_46
Accession: M4ECH7
Uniprot status: Unreviewed
Organism: Brassica rapa
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.
Sequence Information back to top
Sequence length: 277
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|M4ECH7|M4ECH7_BRARP|Unreviewed|Brassica_rapa|277
MAIFNTHNTWAFAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLW
LYYATQKKDVFLLVTINSFGCVIETIYIAIFVAFATKEARMFTVKLLLLMNFGGFFLILL
LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVV
WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLVEKELEAAKLPEVSIDM
LKLGTLVASPEPAVITVVRPVSMCVCNDKKAEAGNGA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 216
Alignment file: M4ECH7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M4ECH7_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 4.7% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M4ECH7_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 4.7% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M4ECH7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 5.8% allowed 2.1% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA