| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M4E1W1
dbSWEET id: dbswt_205
Accession: M4E1W1
Uniprot status: Unreviewed
Organism: Brassica rapa
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.
Sequence Information back to top
Sequence length: 289
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|M4E1W1|M4E1W1_BRARP|Unreviewed|Brassica_rapa|289
MAVSIVVLRTVFGILGNIISFLVCLAPIPTFIRIYKRKSSEGYQSIPYVIALFSAMLWIY
YAMIKTNVVIMITINAVSLVIQIFYISFYLFYAPKKEKTLTVKFVLFVDVFAFGFIFFLT
YFLLHGQKRVQILGYICMVFSLCVFVAPLGIIRKVIKTRSAEFMPFGLSFFLTLSAVMWF
FYGLLLKDMNIALPNVLGFIFGVLQMILYMIYKKPGTKVLEPPVINLQEISDHVVDVVRL
SSMVCSSQMRTLVPQDSADMEDTITIDEKIKGDIEKMKESKEMLLISKN
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 214
Alignment file: M4E1W1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M4E1W1_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.3% favored 5.2% allowed .0% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M4E1W1_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 5.2% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M4E1W1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.8% favored 5.2% allowed 1.0% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22