| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M4E1I6
dbSWEET id: dbswt_567
Accession: M4E1I6
Uniprot status: Unreviewed
Organism: Brassica rapa
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.
Sequence Information back to top
Sequence length: 259
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMA CVV: 411 CHI: 4
Fasta sequence:
>tr|M4E1I6|M4E1I6_BRARP|Unreviewed|Brassica_rapa|259
MGDKLRLFIGILGNGASMLLYTAPILTFSRVFKKKSTEEFSCFPYVMTLLNCLIYTWYGL
PIVSHLWENLPLVTINGVGIFLESLFIFIYFYYSSPKEKVKVGVIFVPVVVVLFGLTAVI
SAVVFDEPRHRKSFVGSVGLVASISMYGSPLVVMKKVIETKSVEYMPFYLSFFSFLASSL
WLAYGLLSHDLFLASPNMVGTPLGILQLILYCKYKNKETPIITTVMSKWDDEKNKRELEL
VVDVDHDGHAKEKKFNYAC
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 216
Alignment file: M4E1I6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M4E1I6_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 6.4% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M4E1I6_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 6.4% allowed 1.1% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M4E1I6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.8% favored 9.1% allowed 1.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA