| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M4DXE4
dbSWEET id: dbswt_510
Accession: M4DXE4
Uniprot status: Unreviewed
Organism: Brassica rapa
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.
Sequence Information back to top
Sequence length: 231
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VGMN CVV: 373 CHI: 2.2
Fasta sequence:
>tr|M4DXE4|M4DXE4_BRARP|Unreviewed|Brassica_rapa|231
MAELSFYVGVIGNVISVLVFLSPVEAFWKIVKRRSTEEYECLPYICTLLGSSLWTYYGIV
TPGEYLVSTVNGFGVLAESIYVLIFLFFVPKPRFLKTITLVLALNILFPVIAIVGTRTAF
GDAKTRSNSMGFICATLNIIMYGSPLSAIKTVVTTKSVKYMPFWLSFFLFLNGAIWGVYA
LLVHDVFLLVPNGMGFFLGTMQLLIYAFYRNAKPNVKDEEEALAPSQPLLS
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: M4DXE4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M4DXE4_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.4% favored 3.8% allowed 2.2% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M4DXE4_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 5.5% allowed 2.2% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M4DXE4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.0% favored 4.4% allowed 1.1% week .5% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA