Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M4D1X7

dbSWEET id: dbswt_16

Accession:   M4D1X7

Uniprot status:   Unreviewed

Organism:   Brassica rapa

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.

Sequence Information back to top


Sequence length:   272

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|M4D1X7|M4D1X7_BRARP|Unreviewed|Brassica_rapa|272
MALNVLAFTFGIMGNIISFIVFLAPVPTFVRICKKKSTEGFQSLPYVSALFSAMLWIYYA
MQKDGSGFLLITINSVGCFIETIYIVLFITYANKKARISTLKVLGLLNFLGFAAIILVCE
LLTKGSNREKVLGGICVGFSVCVFAAPLSIMRVVIRTKSVEFMPFSLSLFLTLSAITWLF
YGLAIKDFYVALPNIMGAFLGAVQMILYIIYKYYKAPKTDDTEKPKTVSGHSIDMVKLAS
TPASGDLKAPPQTHGGDLEGQIEKEMANQIQT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   213

Alignment file: M4D1X7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M4D1X7_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.2% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M4D1X7_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.2% favored    3.7% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M4D1X7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.5% favored    6.9% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur