Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M4CPP6

dbSWEET id: dbswt_99

Accession:   M4CPP6

Uniprot status:   Unreviewed

Organism:   Brassica rapa

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Brassiceae ⇒ Brassica.

Sequence Information back to top


Sequence length:   316

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   ESVS           CVV:   360       CHI:   -0.9

Fasta sequence:

>tr|M4CPP6|M4CPP6_BRARP|Unreviewed|Brassica_rapa|316
MKGNTGFSFPHFLGFAIYLSVSRIHKRRRTGEASSVRFPTEAHPNDEAFNPILWPTFYRI
YKNKSTESFQSLPYQVSLFSCMLWLYYALIKQDAFLLITINSFGCIVETIYIALFFAYAT
RDKRIAAMKLFFTINVAFFSLILMITHFAVRSPSLQVSVIGWICVSISVSVFAAPLMIVA
RVIKTKSVEFMPFTLSFFLTISAVMWFAYGAFLHDICIAIPNVVGFILGMLQMVLYGIYR
NSGVKIDTEKKINSSEQQLKTIVVMSQLGVSEVHPVDITVDPLSETVHHEDPSKQKEPSI
EDGKCHVGTVARFEYI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   26     Model end:   241

Alignment file: M4CPP6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M4CPP6_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.9% favored    5.6% allowed    1.0% week    1.5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M4CPP6_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.4% favored    5.6% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M4CPP6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    7.6% allowed    2.5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur