Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M3ZYK1

dbSWEET id: dbswt_1213

Accession:   M3ZYK1

Uniprot status:   Unreviewed

Organism:   Xiphophorus maculatus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Actinopterygii ⇒ Neopterygii ⇒ Teleostei ⇒ Neoteleostei ⇒ Acanthomorphata ⇒ Ovalentaria ⇒ Atherinomorphae ⇒ Cyprinodontiformes ⇒ Poeciliidae ⇒ Poeciliinae ⇒ Xiphophorus.

Sequence Information back to top


Sequence length:   219

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMT           CVV:   437       CHI:   -0.4

Fasta sequence:

>tr|M3ZYK1|M3ZYK1_XIPMA|Unreviewed|Xiphophorus_maculatus|219
MDLTQLLSWACIVFTVGMFSTGLTDLKKMRESKSADNIQFLPFLTTCLNNLGWLFYGTLK
RDHTIVVVNVIGALLQILYIVMYFLYTKQKRLVVLQTLAAAAVLVCGWLYFTTVLTEGEA
RLNQLGLTCSVVTVSMYLSPLTDLVAIIRSGNVQVLSFPLTVATFFTSTAWVLYGLQLND
YYIMVPNTPGIFTSLIRFYLFRKFATTSQGSPSYKPLHT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   206

Alignment file: M3ZYK1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M3ZYK1_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    4.3% allowed    2.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M3ZYK1_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    5.3% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M3ZYK1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.8% favored    9.1% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur