Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : M3Y2T0
dbSWEET id: dbswt_1212
Accession: M3Y2T0
Uniprot status: Unreviewed
Organism: Mustela putorius
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Laurasiatheria ⇒ Carnivora ⇒ Caniformia ⇒ Mustelidae ⇒ Mustelinae ⇒ Mustela.
Sequence Information back to top
Sequence length: 221
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMT CVV: 437 CHI: -0.4
Fasta sequence:
>tr|M3Y2T0|M3Y2T0_MUSPF|Unreviewed|Mustela_putorius|221
MEAGGAADSLLSGACVLFTLAMYSTGLSDLRQMRTTRSVDSVQFLPFLTTDINNLSWMSY
GTLKGDGTLIFVNATGAVLQTAYILVYLHYCPRKRPVLLQTATLLGVLLLGFGYFWLLVP
NLEARLRQLGLFCSIFTISMYLSPLADLAKIIQTRSTQRLSFPLTIATLLTSASWTLYGF
RLGDPYIMVPNLPGVLTSVIRLWLFWKYSREQDRSHPLLQT
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: M3Y2T0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: M3Y2T0_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.5% favored 2.7% allowed 2.2% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: M3Y2T0_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 7.1% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: M3Y2T0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.3% favored 7.7% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 101674239 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0005794 - Golgi apparatus
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0042947 - glucoside transmembrane transporter activity
GO:0008643 - carbohydrate transport
GO:0045815 - positive regulation of gene expression epigenetic
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA