Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M3Y2T0

dbSWEET id: dbswt_1212

Accession:   M3Y2T0

Uniprot status:   Unreviewed

Organism:   Mustela putorius

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Laurasiatheria ⇒ Carnivora ⇒ Caniformia ⇒ Mustelidae ⇒ Mustelinae ⇒ Mustela.

Sequence Information back to top


Sequence length:   221

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMT           CVV:   437       CHI:   -0.4

Fasta sequence:

>tr|M3Y2T0|M3Y2T0_MUSPF|Unreviewed|Mustela_putorius|221
MEAGGAADSLLSGACVLFTLAMYSTGLSDLRQMRTTRSVDSVQFLPFLTTDINNLSWMSY
GTLKGDGTLIFVNATGAVLQTAYILVYLHYCPRKRPVLLQTATLLGVLLLGFGYFWLLVP
NLEARLRQLGLFCSIFTISMYLSPLADLAKIIQTRSTQRLSFPLTIATLLTSASWTLYGF
RLGDPYIMVPNLPGVLTSVIRLWLFWKYSREQDRSHPLLQT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: M3Y2T0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M3Y2T0_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.5% favored    2.7% allowed    2.2% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M3Y2T0_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    7.1% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M3Y2T0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.3% favored    7.7% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   101674239     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0005794 - Golgi apparatus

GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0042947 - glucoside transmembrane transporter activity

GO:0008643 - carbohydrate transport

GO:0045815 - positive regulation of gene expression epigenetic

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur