Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : M3XFN7

dbSWEET id: dbswt_1211

Accession:   M3XFN7

Uniprot status:   Unreviewed

Organism:   Felis catus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Craniata ⇒ Vertebrata ⇒ Euteleostomi ⇒ Mammalia ⇒ Eutheria ⇒ Laurasiatheria ⇒ Carnivora ⇒ Feliformia ⇒ Felidae ⇒ Felinae ⇒ Felis.

Sequence Information back to top


Sequence length:   219

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMT           CVV:   437       CHI:   -0.4

Fasta sequence:

>tr|M3XFN7|M3XFN7_FELCA|Unreviewed|Felis_catus|219
XGGVADSFLSGACVLFTLIMYSTGLSDLRHMRMTRSVDSVQFLPFLTTDINNLSWLSYGA
LKGDGTLIFVNATGAVLQTLYISVYLHYCPRKRPMLLQTATLLGVLVLGFGYFWLLVPSL
EARLQQLGLFCSTFTISMYLSPLADLAKVIQTKSTQRLSFSLTIATLLTSASWTLYGFQL
RDPYIMVPNVPGILTSFIRLWLFWKYSQGQDRNYPLLQT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   208

Alignment file: M3XFN7.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  M3XFN7_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    5.5% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  M3XFN7_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.4% favored    5.5% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  M3XFN7_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    6.6% allowed    1.1% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0005794 - Golgi apparatus

GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0042947 - glucoside transmembrane transporter activity

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

GO:0045815 - positive regulation of gene expression epigenetic

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur