Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : M3H451
dbSWEET id: dbswt_1863
Accession: M3H451
Uniprot status: Unreviewed
Organism: Leptospira weilii
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|M3H451|M3H451_9LEPT|Unreviewed|Leptospira weilii|88
MDSITFLGYIASLLTTVSFLPQLIRIVMGGSTKDISRNMYIVLVTGVTLWFIYGCLKQDF
PIILANTFTFLFTSIILFLKLRNDSRNK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: M3H451_inward.pdb Alignment file: M3H451_inw.pir Procheck score ⇒ Ramachandran plot: 93.4% favored 5.1% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: M3H451_outward.pdb Alignment file: M3H451_out.pir Procheck score ⇒ Ramachandran plot: 94.9% favored 5.1% allowed .0% week .0% disallowed Occluded: Model structure: M3H451_occluded.pdb Alignment file: M3H451_occ.pir Procheck score ⇒ Ramachandran plot: 98.5% favored 1.5% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA