Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : M3GZ76
dbSWEET id: dbswt_1862
Accession: M3GZ76
Uniprot status: Unreviewed
Organism: Campylobacter showae
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Epsilonproteobacteria ⇒ Campylobacterales ⇒ Campylobacteraceae ⇒ Campylobacter.
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|M3GZ76|M3GZ76_9PROT|Unreviewed|Campylobacter showae|85
MSEKNLQILGWIGTCLSVIMYISYIPQIMGNLEGNKTPFIQPLAAAINCTIWTSYGLLKA
KRDYPLAAANLPGIIFGLLATITAF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: M3GZ76_inward.pdb Alignment file: M3GZ76_inw.pir Procheck score ⇒ Ramachandran plot: 88.9% favored 9.5% allowed .8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: M3GZ76_outward.pdb Alignment file: M3GZ76_out.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 7.9% allowed .8% week .0% disallowed Occluded: Model structure: M3GZ76_occluded.pdb Alignment file: M3GZ76_occ.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 7.1% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA