| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : M2QKA0
dbSWEET id: dbswt_1861
Accession: M2QKA0
Uniprot status: Unreviewed
Organism: Treponema denticola
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|M2QKA0|M2QKA0_TREDN|Unreviewed|Treponema denticola|86
MNSKFFTILGWVATATAMAMYVSYIPQISNNLNGMKGNWLQPLVAAINCTLWVTYGLMKK
PKRDWPIAFANSPGIIFGLVAFITAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: M2QKA0_inward.pdb Alignment file: M2QKA0_inw.pir Procheck score ⇒ Ramachandran plot: 88.5% favored 10.0% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: M2QKA0_outward.pdb Alignment file: M2QKA0_out.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 5.4% allowed .8% week 1.5% disallowed Occluded: Model structure: M2QKA0_occluded.pdb Alignment file: M2QKA0_occ.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 4.6% allowed 1.5% week 1.5% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA